SCOPe 2.08: Domain d1w03a_: 1w03 A:

Lineage for d1w03a_ (1w03 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.1: Penicillin synthase-like [51198] (5 proteins)
   common fold is rather distorted

6. Protein Isopenicillin N synthase [51199] (3 species)

7. Species Emericella nidulans [TaxId:162425] [51200] (27 PDB entries)
   Uniprot P05326

8. Domain d1w03a_: 1w03 A: [120556]
   automated match to d1bk0__
   complexed with fe2, hcg, so4

Details for d1w03a_

PDB Entry: 1w03, 2.1 Å

PDB Description: isopenicillin n synthase aminoadipoyl-cysteinyl-glycine-fe complex

PDB Compounds: (A:) isopenicillin n synthetase

SCOPe Domain Sequences for d1w03a_:

Sequence; same for both SEQRES and ATOM records:

>d1w03a_ b.82.2.1 (A:) Isopenicillin N synthase {Emericella nidulans [TaxId: 162425]}
svskanvpkidvsplfgddqaakmrvaqqidaasrdtgffyavnhginvqrlsqktkefh
msitpeekwdlairaynkehqdqvragyylsipgkkavesfcylnpnftpdhpriqaktp
thevnvwpdetkhpgfqdfaeqyywdvfglssallkgyalalgkeenffarhfkpddtla
svvlirypyldpypeaaiktaadgtklsfewhedvslitvlyqsnvqnlqvetaagyqdi
eaddtgylincgsymahltnnyykapihrvkwvnaerqslpffvnlgydsvidpfdprep
ngksdreplsygdylqnglvslinkngqt

Timeline for d1w03a_:

• d1w03a_ first appeared in SCOP 1.73, called d1w03a1
  
• d1w03a_ appears in SCOPe 2.07