Lineage for d1w00b1 (1w00 B:2-128)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 718640Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 718985Superfamily d.17.4: NTF2-like [54427] (13 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 719067Family d.17.4.3: Ketosteroid isomerase-like [54434] (2 proteins)
  6. 719068Protein Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54435] (2 species)
  7. 719094Species Pseudomonas putida [TaxId:303] [54437] (20 PDB entries)
  8. 719113Domain d1w00b1: 1w00 B:2-128 [120555]
    automatically matched to 1W00 A:2-128
    mutant

Details for d1w00b1

PDB Entry: 1w00 (more details), 2.2 Å

PDB Description: Crystal structure of mutant enzyme Y32F of Ketosteroid Isomerase from Pseudomonas putida biotype B
PDB Compounds: (B:) steroid delta-isomerase

SCOP Domain Sequences for d1w00b1:

Sequence, based on SEQRES records: (download)

>d1w00b1 d.17.4.3 (B:2-128) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]}
nlptaqevqglmaryielvdvgdieaivqmyaddatvedpfgqppihgreqiaafyrqgl
gggkvracltgpvrashngcgampfrvemvwngqpcaldvilvmrfdehgriqtmqayws
evnlsvr

Sequence, based on observed residues (ATOM records): (download)

>d1w00b1 d.17.4.3 (B:2-128) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]}
nlptaqevqglmaryielvdvgdieaivqmyaddatvedpfgqppihgreqiaafyrqgl
kvracltgpvrashngcgampfrvemvwngqpcaldvilvmrfdehgriqtmqaywsevn
lsvr

SCOP Domain Coordinates for d1w00b1:

Click to download the PDB-style file with coordinates for d1w00b1.
(The format of our PDB-style files is described here.)

Timeline for d1w00b1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1w00a1