SCOPe 2.01: Domain d1vyqc_: 1vyq C:

Lineage for d1vyqc_ (1vyq C:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (2 families)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.1: dUTPase-like [51284] (5 proteins)

6. Protein automated matches [190798] (2 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [188061] (1 PDB entry)

8. Domain d1vyqc_: 1vyq C: [120550]
   Other proteins in same PDB: d1vyqa1
   automated match to d1vyqa1
   complexed with dux

Details for d1vyqc_

PDB Entry: 1vyq, 2.4 Å

PDB Description: novel inhibitors of plasmodium falciparum dutpase provide a platform for anti-malarial drug design

PDB Compounds: (C:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d1vyqc_:

Sequence, based on SEQRES records:

>d1vyqc_ b.85.4.1 (C:) automated matches {Plasmodium falciparum [TaxId: 36329]}
mhlkivclsdevremyknhkthhegdsgldlfivkdevlkpksttfvklgikaialqyks
nyyykceksenkkkdddksnivntsfllfprssisktplrlansiglidagyrgeiiaal
dntsdqeyhikkndklvqlvsftgeplsfelveel

Sequence, based on observed residues (ATOM records):

>d1vyqc_ b.85.4.1 (C:) automated matches {Plasmodium falciparum [TaxId: 36329]}
mhlkivclsdevremyknhkthhdsgldlfivkdevlkpksttfvklgikaialqyksny
yykksnivntsfllfprssisktplrlansiglidagyrgeiiaaldntsdqeyhikknd
klvqlvsftgeplsfelveel

Timeline for d1vyqc_:

• d1vyqc_ first appeared in SCOP 1.73, called d1vyqc1
  
• d1vyqc_ was called d1vyqc1 in SCOP 1.75
  
• d1vyqc_ appears in SCOPe 2.02
  
• d1vyqc_ appears in the current release, SCOPe 2.08