SCOP 1.75: Domain d1vyqc1: 1vyq C:1-155

Lineage for d1vyqc1 (1vyq C:1-155)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (1 family)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.1: dUTPase-like [51284] (4 proteins)

6. Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (6 species)

7. Species Plasmodium falciparum [TaxId:5833] [141654] (1 PDB entry)
   Uniprot Q8II92 1-159

8. Domain d1vyqc1: 1vyq C:1-155 [120550]
   automatically matched to 1VYQ A:1-159
   complexed with dux

Details for d1vyqc1

PDB Entry: 1vyq, 2.4 Å

PDB Description: novel inhibitors of plasmodium falciparum dutpase provide a platform for anti-malarial drug design

PDB Compounds: (C:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOP Domain Sequences for d1vyqc1:

Sequence, based on SEQRES records:

>d1vyqc1 b.85.4.1 (C:1-155) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Plasmodium falciparum [TaxId: 5833]}
mhlkivclsdevremyknhkthhegdsgldlfivkdevlkpksttfvklgikaialqyks
nyyykceksenkkkdddksnivntsfllfprssisktplrlansiglidagyrgeiiaal
dntsdqeyhikkndklvqlvsftgeplsfelveel

Sequence, based on observed residues (ATOM records):

>d1vyqc1 b.85.4.1 (C:1-155) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Plasmodium falciparum [TaxId: 5833]}
mhlkivclsdevremyknhkthhdsgldlfivkdevlkpksttfvklgikaialqyksny
yykksnivntsfllfprssisktplrlansiglidagyrgeiiaaldntsdqeyhikknd
klvqlvsftgeplsfelveel

Timeline for d1vyqc1:

• d1vyqc1 first appeared in SCOP 1.73
  
• d1vyqc1 is called d1vyqc_ in SCOPe 2.01
  
• d1vyqc1 appears in the current release, SCOPe 2.08, called d1vyqc_