Lineage for d1vyqc1 (1vyq C:1-155)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 678386Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 678502Superfamily b.85.4: dUTPase-like [51283] (1 family) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 678503Family b.85.4.1: dUTPase-like [51284] (4 proteins)
  6. 678534Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (6 species)
  7. 678592Species Plasmodium falciparum [TaxId:5833] [141654] (1 PDB entry)
  8. 678595Domain d1vyqc1: 1vyq C:1-155 [120550]
    automatically matched to 1VYQ A:1-159
    complexed with dux

Details for d1vyqc1

PDB Entry: 1vyq (more details), 2.4 Å

PDB Description: novel inhibitors of plasmodium falciparum dutpase provide a platform for anti-malarial drug design
PDB Compounds: (C:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOP Domain Sequences for d1vyqc1:

Sequence, based on SEQRES records: (download)

>d1vyqc1 b.85.4.1 (C:1-155) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Plasmodium falciparum [TaxId: 5833]}
mhlkivclsdevremyknhkthhegdsgldlfivkdevlkpksttfvklgikaialqyks
nyyykceksenkkkdddksnivntsfllfprssisktplrlansiglidagyrgeiiaal
dntsdqeyhikkndklvqlvsftgeplsfelveel

Sequence, based on observed residues (ATOM records): (download)

>d1vyqc1 b.85.4.1 (C:1-155) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Plasmodium falciparum [TaxId: 5833]}
mhlkivclsdevremyknhkthhdsgldlfivkdevlkpksttfvklgikaialqyksny
yykksnivntsfllfprssisktplrlansiglidagyrgeiiaaldntsdqeyhikknd
klvqlvsftgeplsfelveel

SCOP Domain Coordinates for d1vyqc1:

Click to download the PDB-style file with coordinates for d1vyqc1.
(The format of our PDB-style files is described here.)

Timeline for d1vyqc1: