Class b: All beta proteins [48724] (165 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.4: dUTPase-like [51283] (1 family) forms tight trimer through an additional beta-sheet in each subunit subunit beta-sheets are orthogonally packed around the three-fold axis |
Family b.85.4.1: dUTPase-like [51284] (4 proteins) |
Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (6 species) |
Species Plasmodium falciparum [TaxId:5833] [141654] (1 PDB entry) |
Domain d1vyqc1: 1vyq C:1-155 [120550] automatically matched to 1VYQ A:1-159 complexed with dux |
PDB Entry: 1vyq (more details), 2.4 Å
SCOP Domain Sequences for d1vyqc1:
Sequence, based on SEQRES records: (download)
>d1vyqc1 b.85.4.1 (C:1-155) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Plasmodium falciparum [TaxId: 5833]} mhlkivclsdevremyknhkthhegdsgldlfivkdevlkpksttfvklgikaialqyks nyyykceksenkkkdddksnivntsfllfprssisktplrlansiglidagyrgeiiaal dntsdqeyhikkndklvqlvsftgeplsfelveel
>d1vyqc1 b.85.4.1 (C:1-155) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Plasmodium falciparum [TaxId: 5833]} mhlkivclsdevremyknhkthhdsgldlfivkdevlkpksttfvklgikaialqyksny yykksnivntsfllfprssisktplrlansiglidagyrgeiiaaldntsdqeyhikknd klvqlvsftgeplsfelveel
Timeline for d1vyqc1: