Class b: All beta proteins [48724] (174 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.4: dUTPase-like [51283] (2 families) forms tight trimer through an additional beta-sheet in each subunit subunit beta-sheets are orthogonally packed around the three-fold axis |
Family b.85.4.1: dUTPase-like [51284] (5 proteins) |
Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (7 species) |
Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [141654] (1 PDB entry) Uniprot Q8II92 1-159 |
Domain d1vyqa1: 1vyq A:1-159 [120548] Other proteins in same PDB: d1vyqb_, d1vyqc_ complexed with dux |
PDB Entry: 1vyq (more details), 2.4 Å
SCOPe Domain Sequences for d1vyqa1:
Sequence, based on SEQRES records: (download)
>d1vyqa1 b.85.4.1 (A:1-159) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} mhlkivclsdevremyknhkthhegdsgldlfivkdevlkpksttfvklgikaialqyks nyyykceksenkkkdddksnivntsfllfprssisktplrlansiglidagyrgeiiaal dntsdqeyhikkndklvqlvsftgeplsfelveeldets
>d1vyqa1 b.85.4.1 (A:1-159) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} mhlkivclsdevremyknhkthhedsgldlfivkdevlkpksttfvklgikaialqyksn yynivntsfllfprssisktplrlansiglidagyrgeiiaaldntsdqeyhikkndklv qlvsftgeplsfelveeldets
Timeline for d1vyqa1: