| Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
| Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (2 families) ![]() |
| Family d.131.1.2: DNA polymerase processivity factor [55983] (4 proteins) duplication: consists of two domains of this fold |
| Protein Proliferating cell nuclear antigen (PCNA) [55989] (5 species) |
| Species Human (Homo sapiens) [TaxId:9606] [55991] (7 PDB entries) |
| Domain d1vymb2: 1vym B:127-255 [120545] automatically matched to d1axca2 |
PDB Entry: 1vym (more details), 2.3 Å
SCOP Domain Sequences for d1vymb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vymb2 d.131.1.2 (B:127-255) Proliferating cell nuclear antigen (PCNA) {Human (Homo sapiens) [TaxId: 9606]}
gipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngniklsqts
nvdkeeeavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveykiadmgh
lkyylapki
Timeline for d1vymb2:
View in 3DDomains from other chains: (mouse over for more information) d1vyma1, d1vyma2, d1vymc1, d1vymc2 |