SCOP 1.73: Domain d1vyjc2: 1vyj C:127-255

Lineage for d1vyjc2 (1vyj C:127-255)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (2 families)

5. Family d.131.1.2: DNA polymerase processivity factor [55983] (4 proteins)
   duplication: consists of two domains of this fold

6. Protein Proliferating cell nuclear antigen (PCNA) [55989] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55991] (7 PDB entries)

8. Domain d1vyjc2: 1vyj C:127-255 [120533]
   automatically matched to d1axca2

Details for d1vyjc2

PDB Entry: 1vyj, 2.8 Å

PDB Description: structural and biochemical studies of human pcna complexes provide the basis for association with cdk/cyclin and rationale for inhibitor design

PDB Compounds: (C:) Proliferating Cell Nuclear Antigen

SCOP Domain Sequences for d1vyjc2:

Sequence; same for both SEQRES and ATOM records:

>d1vyjc2 d.131.1.2 (C:127-255) Proliferating cell nuclear antigen (PCNA) {Human (Homo sapiens) [TaxId: 9606]}
gipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngniklsqts
nvdkeeeavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveykiadmgh
lkyylapki

Timeline for d1vyjc2:

• d1vyjc2 is new in SCOP 1.73
  
• d1vyjc2 appears in SCOP 1.75
  
• d1vyjc2 appears in the current release, SCOPe 2.08