Lineage for d1vyhq1 (1vyh Q:6-217)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 825505Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 826290Superfamily c.23.10: SGNH hydrolase [52266] (9 families) (S)
  5. 826303Family c.23.10.3: Acetylhydrolase [52273] (2 proteins)
  6. 826304Protein Platelet-activating factor acetylhydrolase [52274] (2 species)
  7. 826312Species Cow (Bos taurus), alpha2 [TaxId:9913] [88721] (2 PDB entries)
  8. 826322Domain d1vyhq1: 1vyh Q:6-217 [120528]
    Other proteins in same PDB: d1vyhc1, d1vyhd1, d1vyhg1, d1vyhh1, d1vyhk1, d1vyhl1, d1vyho1, d1vyhp1, d1vyhs1, d1vyht1
    automatically matched to d1fxwf_

Details for d1vyhq1

PDB Entry: 1vyh (more details), 3.4 Å

PDB Description: paf-ah holoenzyme: lis1/alfa2
PDB Compounds: (Q:) platelet-activating factor acetylhydrolase ib beta subunit

SCOP Domain Sequences for d1vyhq1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vyhq1 c.23.10.3 (Q:6-217) Platelet-activating factor acetylhydrolase {Cow (Bos taurus), alpha2 [TaxId: 9913]}
snpaaiphaaediqgddrwmsqhnrfvldckdkepdvlfvgdsmvqlmqqyeiwrelfsp
lhalnfgiggdttrhvlwrlkngelenikpkvivvwvgtnnhentaeevaggieaivqli
ntrqpqakiivlgllprgekpnplrqknakvnqllkvslpklanvqlldtdggfvhsdga
ischdmfdflhltgggyakickplhelimqll

SCOP Domain Coordinates for d1vyhq1:

Click to download the PDB-style file with coordinates for d1vyhq1.
(The format of our PDB-style files is described here.)

Timeline for d1vyhq1: