Lineage for d1vsaw1 (1vsa W:12-62)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2303207Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2303233Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family) (S)
    automatically mapped to Pfam PF00831
  5. 2303234Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein)
  6. 2303235Protein Ribosomal protein L29 (L29p) [46563] (5 species)
  7. 2303319Species Thermus thermophilus [TaxId:274] [140100] (10 PDB entries)
    Uniprot Q5SHP6 12-62
  8. 2303325Domain d1vsaw1: 1vsa W:12-62 [120519]
    Other proteins in same PDB: d1vsaa1, d1vsab1, d1vsac1, d1vsaf1, d1vsaf2, d1vsah1, d1vsai1, d1vsaj1, d1vsal1, d1vsam1, d1vsao1, d1vsap1, d1vsaq1, d1vsar1, d1vsas1, d1vsat1, d1vsau1, d1vsax1, d1vsaz1
    protein/RNA complex
    protein/RNA complex

Details for d1vsaw1

PDB Entry: 1vsa (more details), 3.71 Å

PDB Description: Crystal Structure of a 70S Ribosome-tRNA Complex Reveals Functional Interactions and Rearrangements. This file, 1VSA, contains the 50S ribosome subunit. 30S ribosome subunit is in the file 2OW8
PDB Compounds: (W:) 50S ribosomal protein L29

SCOPe Domain Sequences for d1vsaw1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vsaw1 a.2.2.1 (W:12-62) Ribosomal protein L29 (L29p) {Thermus thermophilus [TaxId: 274]}
earklspveleklvrekkrelmelrfqasigqlsqnhkirdlkrqiarllt

SCOPe Domain Coordinates for d1vsaw1:

Click to download the PDB-style file with coordinates for d1vsaw1.
(The format of our PDB-style files is described here.)

Timeline for d1vsaw1: