![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
![]() | Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family) ![]() |
![]() | Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein) |
![]() | Protein Ribosomal protein L29 (L29p) [46563] (5 species) |
![]() | Species Thermus thermophilus [TaxId:274] [140100] (6 PDB entries) Uniprot Q5SHP6 12-62 |
![]() | Domain d1vsaw1: 1vsa W:12-62 [120519] Other proteins in same PDB: d1vsaa1, d1vsab1, d1vsac1, d1vsaf1, d1vsaf2, d1vsah1, d1vsai1, d1vsaj1, d1vsal1, d1vsam1, d1vsao1, d1vsap1, d1vsaq1, d1vsar1, d1vsas1, d1vsat1, d1vsau1, d1vsax1, d1vsaz1 automatically matched to 2J01 2:12-62 protein/RNA complex |
PDB Entry: 1vsa (more details), 3.71 Å
SCOPe Domain Sequences for d1vsaw1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vsaw1 a.2.2.1 (W:12-62) Ribosomal protein L29 (L29p) {Thermus thermophilus [TaxId: 274]} earklspveleklvrekkrelmelrfqasigqlsqnhkirdlkrqiarllt
Timeline for d1vsaw1: