![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies) sandwich of half-barrel shaped beta-sheets |
![]() | Superfamily b.84.4: Ribosomal L27 protein-like [110324] (2 families) ![]() rudiment single hybrid fold with a permuted topology |
![]() | Family b.84.4.1: Ribosomal L27 protein [110325] (1 protein) Pfam PF01016 |
![]() | Protein Ribosomal protein L27 [110326] (3 species) |
![]() | Species Thermus thermophilus [TaxId:274] [110327] (2 PDB entries) Uniprot P84123 |
![]() | Domain d1vsau1: 1vsa U:20-85 [120518] Other proteins in same PDB: d1vsaa1, d1vsab1, d1vsac1, d1vsaf1, d1vsaf2, d1vsah1, d1vsai1, d1vsaj1, d1vsal1, d1vsam1, d1vsao1, d1vsap1, d1vsaq1, d1vsar1, d1vsas1, d1vsat1, d1vsaw1, d1vsax1, d1vsaz1 automatically matched to d1v8qa_ protein/RNA complex |
PDB Entry: 1vsa (more details), 3.71 Å
SCOPe Domain Sequences for d1vsau1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vsau1 b.84.4.1 (U:20-85) Ribosomal protein L27 {Thermus thermophilus [TaxId: 274]} rlgvkryegqvvragnilvrqrgtrfkpgknvgmgrdftlfalvdgvvefqdrgrlgryv hvrpla
Timeline for d1vsau1: