Lineage for d1vsab1 (1vsa b:2-36)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1066861Fold g.42: Ribosomal protein L36 [57839] (1 superfamily)
    zinc-bound beta-ribbon motif
  4. 1066862Superfamily g.42.1: Ribosomal protein L36 [57840] (1 family) (S)
  5. 1066863Family g.42.1.1: Ribosomal protein L36 [57841] (1 protein)
  6. 1066864Protein Ribosomal protein L36 [57842] (3 species)
  7. 1066904Species Thermus thermophilus [TaxId:274] [57843] (6 PDB entries)
  8. 1066910Domain d1vsab1: 1vsa b:2-36 [120517]
    Other proteins in same PDB: d1vsaa1, d1vsac1, d1vsaf1, d1vsaf2, d1vsah1, d1vsai1, d1vsaj1, d1vsal1, d1vsam1, d1vsao1, d1vsap1, d1vsaq1, d1vsar1, d1vsas1, d1vsat1, d1vsau1, d1vsaw1, d1vsax1, d1vsaz1
    automatically matched to d1dfea_
    protein/RNA complex

Details for d1vsab1

PDB Entry: 1vsa (more details), 3.71 Å

PDB Description: Crystal Structure of a 70S Ribosome-tRNA Complex Reveals Functional Interactions and Rearrangements. This file, 1VSA, contains the 50S ribosome subunit. 30S ribosome subunit is in the file 2OW8
PDB Compounds: (b:) 50S ribosomal protein L36

SCOPe Domain Sequences for d1vsab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vsab1 g.42.1.1 (b:2-36) Ribosomal protein L36 {Thermus thermophilus [TaxId: 274]}
kvrasvkricdkckvirrhgrvyvicenpkhkqrq

SCOPe Domain Coordinates for d1vsab1:

Click to download the PDB-style file with coordinates for d1vsab1.
(The format of our PDB-style files is described here.)

Timeline for d1vsab1: