Lineage for d1vs6z1 (1vs6 Z:1-70)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 741854Fold d.325: L28p-like [143799] (1 superfamily)
    unusual fold consisting of three beta-hairpins, that form a paper clip-like structure, and two helices; could have evolved from a glucocorticoid receptor-like zinc finger domain (scop_cf 57715)
  4. 741855Superfamily d.325.1: L28p-like [143800] (2 families) (S)
    In early ribosomal structures, L28p has been misinterpreted as L31p. in the Ribosomal protein L28p family, there are sequences containing two CxxC pairs. Threading these sequences into this fold brings the four cysteines in a similar site to the zinc-binding site of glucocorticoid receptor-like zinc fingers. In the Ribosomal protein L31p, there are also members with two CxxC pairs. However, these won't form a putative zinc-binding site in this fold. The L31p family are classified here temporarily, until its true fold is known
  5. 741860Family d.325.1.2: Ribosomal protein L31p [143804] (1 protein)
    Pfam PF01197
  6. 741861Protein Ribosomal protein L31p [143805] (1 species)
  7. 741862Species Escherichia coli [TaxId:562] [143806] (5 PDB entries)
  8. 741863Domain d1vs6z1: 1vs6 Z:1-70 [120502]
    Other proteins in same PDB: d1vs601, d1vs611, d1vs621, d1vs631, d1vs641, d1vs6l1, d1vs6m1, d1vs6p1, d1vs6r1, d1vs6u1, d1vs6v1, d1vs6x1
    automatically matched to 2AW4 Z:1-70
    complexed with mg

Details for d1vs6z1

PDB Entry: 1vs6 (more details), 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from escherichia coli in complex with the antibiotic kasugamyin at 3.5A resolution. this file contains the 50s subunit of one 70s ribosome. the entire crystal structure contains two 70s ribosomes and is described in remark 400.
PDB Compounds: (Z:) 50S ribosomal protein L31

SCOP Domain Sequences for d1vs6z1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vs6z1 d.325.1.2 (Z:1-70) Ribosomal protein L31p {Escherichia coli [TaxId: 562]}
mkkdihpkyeeitascscgnvmkirstvghdlnldvcskchpfftgkqrdvatggrvdrf
nkrfnipgsk

SCOP Domain Coordinates for d1vs6z1:

Click to download the PDB-style file with coordinates for d1vs6z1.
(The format of our PDB-style files is described here.)

Timeline for d1vs6z1: