Lineage for d1vs5h1 (1vs5 H:3-129)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1432719Fold d.140: Ribosomal protein S8 [56046] (1 superfamily)
    consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a
  4. 1432720Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) (S)
    automatically mapped to Pfam PF00410
  5. 1432721Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein)
  6. 1432722Protein Ribosomal protein S8 [56049] (4 species)
  7. 1432726Species Escherichia coli [TaxId:562] [111186] (9 PDB entries)
    Uniprot P02361
  8. 1432731Domain d1vs5h1: 1vs5 H:3-129 [120489]
    Other proteins in same PDB: d1vs5b1, d1vs5c1, d1vs5c2, d1vs5d1, d1vs5e1, d1vs5e2, d1vs5f1, d1vs5g1, d1vs5i1, d1vs5j1, d1vs5k1, d1vs5l1, d1vs5m1, d1vs5n1, d1vs5o1, d1vs5p1, d1vs5q1, d1vs5r1, d1vs5s1, d1vs5t1, d1vs5u1
    automatically matched to d1s03h_
    complexed with ksg, mg

Details for d1vs5h1

PDB Entry: 1vs5 (more details), 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from escherichia coli in complex with the antibiotic kasugamyin at 3.5A resolution. this file contains the 30s subunit of one 70s ribosome. the entire crystal structure contains two 70s ribosomes and is described in remark 400.
PDB Compounds: (H:) 30S ribosomal protein S8

SCOPe Domain Sequences for d1vs5h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vs5h1 d.140.1.1 (H:3-129) Ribosomal protein S8 {Escherichia coli [TaxId: 562]}
qdpiadmltrirngqaankaavtmpssklkvaianvlkeegfiedfkvegdtkpeleltl
kyfqgkavvesiqrvsrpglriykrkdelpkvmaglgiavvstskgvmtdraarqaglgg
eiicyva

SCOPe Domain Coordinates for d1vs5h1:

Click to download the PDB-style file with coordinates for d1vs5h1.
(The format of our PDB-style files is described here.)

Timeline for d1vs5h1: