Lineage for d1vrya1 (1vry A:-2-57)

  1. Root: SCOPe 2.08
  2. 3045664Class j: Peptides [58231] (151 folds)
  3. 3046491Fold j.35: Transmembrane helical fragments [58517] (1 superfamily)
  4. 3046492Superfamily j.35.1: Transmembrane helical fragments [58518] (1 family) (S)
  5. 3046493Family j.35.1.1: Transmembrane helical fragments [58519] (30 proteins)
    the member of this family may be not related
  6. 3046551Protein Glycine receptor alpha-1 chain [103733] (1 species)
  7. 3046552Species Human (Homo sapiens) [TaxId:9606] [103734] (2 PDB entries)
    Uniprot P23415 281-337
  8. 3046553Domain d1vrya1: 1vry A:-2-57 [120488]
    Other proteins in same PDB: d1vrya2

Details for d1vrya1

PDB Entry: 1vry (more details)

PDB Description: second and third transmembrane domains of the alpha-1 subunit of human glycine receptor
PDB Compounds: (A:) Glycine Receptor alpha-1 CHAIN

SCOPe Domain Sequences for d1vrya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vrya1 j.35.1.1 (A:-2-57) Glycine receptor alpha-1 chain {Human (Homo sapiens) [TaxId: 9606]}
parvglgittvltlttqssgsraslpkvsyvkaidiwlavcllfvfsalleyaavnfvsr

SCOPe Domain Coordinates for d1vrya1:

Click to download the PDB-style file with coordinates for d1vrya1.
(The format of our PDB-style files is described here.)

Timeline for d1vrya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vrya2