SCOP 1.73: Domain d1vrsf1: 1vrs F:428-545

Lineage for d1vrsf1 (1vrs F:428-545)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (22 families)

5. Family c.47.1.1: Thioltransferase [52834] (15 proteins)

6. Protein Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) [102435] (1 species)

7. Species Escherichia coli [TaxId:562] [102436] (6 PDB entries)

8. Domain d1vrsf1: 1vrs F:428-545 [120483]
   Other proteins in same PDB: d1vrsa1, d1vrsb1
   automatically matched to d1se1a2
   mutant

Details for d1vrsf1

PDB Entry: 1vrs, 2.85 Å

PDB Description: crystal structure of the disulfide-linked complex between the n- terminal and c-terminal domain of the electron transfer catalyst dsbd

PDB Compounds: (F:) Thiol:disulfide interchange protein dsbD

SCOP Domain Sequences for d1vrsf1:

Sequence; same for both SEQRES and ATOM records:

>d1vrsf1 c.47.1.1 (F:428-545) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]}
hlnftqiktvdelnqalveakgkpvmldlyadwcvaskefekytfsdpqvqkaladtvll
qanvtandaqdvallkhlnvlglptilffdgqgqehpqarvtgfmdaetfsahlrdrq

Timeline for d1vrsf1:

• d1vrsf1 is new in SCOP 1.73
  
• d1vrsf1 appears in SCOP 1.75
  
• d1vrsf1 appears in the current release, SCOPe 2.08, called d1vrsf_