Lineage for d1vrsd_ (1vrs D:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1168056Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1168057Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1168058Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 1168110Protein Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) [102435] (2 species)
  7. 1168111Species Escherichia coli [TaxId:316407] [186806] (1 PDB entry)
  8. 1168112Domain d1vrsd_: 1vrs D: [120481]
    Other proteins in same PDB: d1vrsa_, d1vrsb_, d1vrsc_
    automated match to d1uc7a_

Details for d1vrsd_

PDB Entry: 1vrs (more details), 2.85 Å

PDB Description: crystal structure of the disulfide-linked complex between the n- terminal and c-terminal domain of the electron transfer catalyst dsbd
PDB Compounds: (D:) Thiol:disulfide interchange protein dsbD

SCOPe Domain Sequences for d1vrsd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vrsd_ c.47.1.1 (D:) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 316407]}
hlnftqiktvdelnqalveakgkpvmldlyadwcvaskefekytfsdpqvqkaladtvll
qanvtandaqdvallkhlnvlglptilffdgqgqehpqarvtgfmdaetfsahlrdrq

SCOPe Domain Coordinates for d1vrsd_:

Click to download the PDB-style file with coordinates for d1vrsd_.
(The format of our PDB-style files is described here.)

Timeline for d1vrsd_: