![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.17: Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74863] (2 families) ![]() |
![]() | Family b.1.17.1: Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74864] (2 proteins) |
![]() | Protein Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74865] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [74866] (6 PDB entries) |
![]() | Domain d1vrsb_: 1vrs B: [120480] Other proteins in same PDB: d1vrsd_, d1vrse_, d1vrsf_ automated match to d1vrsa1 |
PDB Entry: 1vrs (more details), 2.85 Å
SCOPe Domain Sequences for d1vrsb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vrsb_ b.1.17.1 (B:) Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) {Escherichia coli [TaxId: 562]} glfdapgrsqfvpadqafafdfqqnqhdlnltwqikdgyylyrkqiritpehakiadvql pqgvwhedefygkseiyrdrltlpvtinqasagatltvtyqgsadagfcyppetktvpls evvan
Timeline for d1vrsb_: