SCOPe 2.01: Domain d1vrsb_: 1vrs B:

Lineage for d1vrsb_ (1vrs B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.17: Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74863] (1 family)

5. Family b.1.17.1: Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74864] (2 proteins)

6. Protein Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74865] (1 species)

7. Species Escherichia coli [TaxId:562] [74866] (5 PDB entries)

8. Domain d1vrsb_: 1vrs B: [120480]
   Other proteins in same PDB: d1vrsd_, d1vrse_, d1vrsf_
   automated match to d1vrsa1

Details for d1vrsb_

PDB Entry: 1vrs, 2.85 Å

PDB Description: crystal structure of the disulfide-linked complex between the n- terminal and c-terminal domain of the electron transfer catalyst dsbd

PDB Compounds: (B:) Thiol:disulfide interchange protein dsbD

SCOPe Domain Sequences for d1vrsb_:

Sequence; same for both SEQRES and ATOM records:

>d1vrsb_ b.1.17.1 (B:) Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) {Escherichia coli [TaxId: 562]}
glfdapgrsqfvpadqafafdfqqnqhdlnltwqikdgyylyrkqiritpehakiadvql
pqgvwhedefygkseiyrdrltlpvtinqasagatltvtyqgsadagfcyppetktvpls
evvan

Timeline for d1vrsb_:

• d1vrsb_ first appeared in SCOP 1.73, called d1vrsb1
  
• d1vrsb_ was called d1vrsb1 in SCOP 1.75
  
• d1vrsb_ appears in SCOPe 2.02
  
• d1vrsb_ appears in the current release, SCOPe 2.08