Lineage for d1vrsb1 (1vrs B:1-125)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 788940Superfamily b.1.17: Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74863] (1 family) (S)
  5. 788941Family b.1.17.1: Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74864] (1 protein)
  6. 788942Protein Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74865] (1 species)
  7. 788943Species Escherichia coli [TaxId:562] [74866] (5 PDB entries)
  8. 788949Domain d1vrsb1: 1vrs B:1-125 [120480]
    Other proteins in same PDB: d1vrsd1, d1vrse1, d1vrsf1
    automatically matched to d1se1a1
    mutant

Details for d1vrsb1

PDB Entry: 1vrs (more details), 2.85 Å

PDB Description: crystal structure of the disulfide-linked complex between the n- terminal and c-terminal domain of the electron transfer catalyst dsbd
PDB Compounds: (B:) Thiol:disulfide interchange protein dsbD

SCOP Domain Sequences for d1vrsb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vrsb1 b.1.17.1 (B:1-125) Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) {Escherichia coli [TaxId: 562]}
glfdapgrsqfvpadqafafdfqqnqhdlnltwqikdgyylyrkqiritpehakiadvql
pqgvwhedefygkseiyrdrltlpvtinqasagatltvtyqgsadagfcyppetktvpls
evvan

SCOP Domain Coordinates for d1vrsb1:

Click to download the PDB-style file with coordinates for d1vrsb1.
(The format of our PDB-style files is described here.)

Timeline for d1vrsb1: