SCOPe 2.06: Domain d1vrsa_: 1vrs A:

Lineage for d1vrsa_ (1vrs A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.17: Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74863] (2 families)

5. Family b.1.17.1: Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74864] (2 proteins)

6. Protein Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74865] (2 species)

7. Species Escherichia coli [TaxId:562] [74866] (6 PDB entries)

8. Domain d1vrsa_: 1vrs A: [120479]
   Other proteins in same PDB: d1vrsd_, d1vrse_, d1vrsf_
   automated match to d1vrsa1

Details for d1vrsa_

PDB Entry: 1vrs, 2.85 Å

PDB Description: crystal structure of the disulfide-linked complex between the n- terminal and c-terminal domain of the electron transfer catalyst dsbd

PDB Compounds: (A:) Thiol:disulfide interchange protein dsbD

SCOPe Domain Sequences for d1vrsa_:

Sequence, based on SEQRES records:

>d1vrsa_ b.1.17.1 (A:) Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) {Escherichia coli [TaxId: 562]}
glfdapgrsqfvpadqafafdfqqnqhdlnltwqikdgyylyrkqiritpehakiadvql
pqgvwhedefygkseiyrdrltlpvtinqasagatltvtyqgsadagfcyppetktvpls
evvan

Sequence, based on observed residues (ATOM records):

>d1vrsa_ b.1.17.1 (A:) Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) {Escherichia coli [TaxId: 562]}
glfdaqfvpadqafafdfqqnqhdlnltwqikdgyylyrkqiritpehakiadvqlpqgv
whedefygkseiyrdrltlpvtinqasagatltvtyqgsadagfcyppetktvplsevva
n

Timeline for d1vrsa_:

• d1vrsa_ first appeared in SCOP 1.73, called d1vrsa1
  
• d1vrsa_ appears in SCOPe 2.05
  
• d1vrsa_ appears in SCOPe 2.07
  
• d1vrsa_ appears in the current release, SCOPe 2.08