Lineage for d1vrsa1 (1vrs A:1-125)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 788940Superfamily b.1.17: Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74863] (1 family) (S)
  5. 788941Family b.1.17.1: Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74864] (1 protein)
  6. 788942Protein Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74865] (1 species)
  7. 788943Species Escherichia coli [TaxId:562] [74866] (5 PDB entries)
  8. 788948Domain d1vrsa1: 1vrs A:1-125 [120479]
    Other proteins in same PDB: d1vrsd1, d1vrse1, d1vrsf1
    automatically matched to d1se1a1
    mutant

Details for d1vrsa1

PDB Entry: 1vrs (more details), 2.85 Å

PDB Description: Crystal structure of the disulfide-linked complex between the N-terminal and C-terminal domain of the electron transfer catalyst DsbD
PDB Compounds: (A:) Thiol:disulfide interchange protein dsbD

SCOP Domain Sequences for d1vrsa1:

Sequence, based on SEQRES records: (download)

>d1vrsa1 b.1.17.1 (A:1-125) Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) {Escherichia coli [TaxId: 562]}
glfdapgrsqfvpadqafafdfqqnqhdlnltwqikdgyylyrkqiritpehakiadvql
pqgvwhedefygkseiyrdrltlpvtinqasagatltvtyqgsadagfcyppetktvpls
evvan

Sequence, based on observed residues (ATOM records): (download)

>d1vrsa1 b.1.17.1 (A:1-125) Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) {Escherichia coli [TaxId: 562]}
glfdaqfvpadqafafdfqqnqhdlnltwqikdgyylyrkqiritpehakiadvqlpqgv
whedefygkseiyrdrltlpvtinqasagatltvtyqgsadagfcyppetktvplsevva
n

SCOP Domain Coordinates for d1vrsa1:

Click to download the PDB-style file with coordinates for d1vrsa1.
(The format of our PDB-style files is described here.)

Timeline for d1vrsa1: