SCOP 1.73: Domain d1vrsa1: 1vrs A:1-125

Lineage for d1vrsa1 (1vrs A:1-125)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.17: Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74863] (1 family)

5. Family b.1.17.1: Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74864] (1 protein)

6. Protein Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74865] (1 species)

7. Species Escherichia coli [TaxId:562] [74866] (5 PDB entries)

8. Domain d1vrsa1: 1vrs A:1-125 [120479]
   Other proteins in same PDB: d1vrsd1, d1vrse1, d1vrsf1
   automatically matched to d1se1a1
   mutant

Details for d1vrsa1

PDB Entry: 1vrs, 2.85 Å

PDB Description: crystal structure of the disulfide-linked complex between the n- terminal and c-terminal domain of the electron transfer catalyst dsbd

PDB Compounds: (A:) Thiol:disulfide interchange protein dsbD

SCOP Domain Sequences for d1vrsa1:

Sequence, based on SEQRES records:

>d1vrsa1 b.1.17.1 (A:1-125) Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) {Escherichia coli [TaxId: 562]}
glfdapgrsqfvpadqafafdfqqnqhdlnltwqikdgyylyrkqiritpehakiadvql
pqgvwhedefygkseiyrdrltlpvtinqasagatltvtyqgsadagfcyppetktvpls
evvan

Sequence, based on observed residues (ATOM records):

>d1vrsa1 b.1.17.1 (A:1-125) Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) {Escherichia coli [TaxId: 562]}
glfdaqfvpadqafafdfqqnqhdlnltwqikdgyylyrkqiritpehakiadvqlpqgv
whedefygkseiyrdrltlpvtinqasagatltvtyqgsadagfcyppetktvplsevva
n

Timeline for d1vrsa1:

• d1vrsa1 is new in SCOP 1.73
  
• d1vrsa1 appears in SCOP 1.75
  
• d1vrsa1 appears in the current release, SCOPe 2.08, called d1vrsa_