Lineage for d1vrsa_ (1vrs A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765029Superfamily b.1.17: Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74863] (2 families) (S)
  5. 2765030Family b.1.17.1: Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74864] (2 proteins)
  6. 2765031Protein Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74865] (2 species)
  7. 2765032Species Escherichia coli [TaxId:562] [74866] (6 PDB entries)
  8. 2765039Domain d1vrsa_: 1vrs A: [120479]
    Other proteins in same PDB: d1vrsd_, d1vrse_, d1vrsf_
    automated match to d1vrsa1

Details for d1vrsa_

PDB Entry: 1vrs (more details), 2.85 Å

PDB Description: crystal structure of the disulfide-linked complex between the n- terminal and c-terminal domain of the electron transfer catalyst dsbd
PDB Compounds: (A:) Thiol:disulfide interchange protein dsbD

SCOPe Domain Sequences for d1vrsa_:

Sequence, based on SEQRES records: (download)

>d1vrsa_ b.1.17.1 (A:) Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) {Escherichia coli [TaxId: 562]}
glfdapgrsqfvpadqafafdfqqnqhdlnltwqikdgyylyrkqiritpehakiadvql
pqgvwhedefygkseiyrdrltlpvtinqasagatltvtyqgsadagfcyppetktvpls
evvan

Sequence, based on observed residues (ATOM records): (download)

>d1vrsa_ b.1.17.1 (A:) Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) {Escherichia coli [TaxId: 562]}
glfdaqfvpadqafafdfqqnqhdlnltwqikdgyylyrkqiritpehakiadvqlpqgv
whedefygkseiyrdrltlpvtinqasagatltvtyqgsadagfcyppetktvplsevva
n

SCOPe Domain Coordinates for d1vrsa_:

Click to download the PDB-style file with coordinates for d1vrsa_.
(The format of our PDB-style files is described here.)

Timeline for d1vrsa_: