Lineage for d1vrra_ (1vrr A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2882263Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2882264Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) (S)
  5. 2882614Family c.52.1.21: Restriction endonuclease BstyI [102471] (1 protein)
    automatically mapped to Pfam PF09195
  6. 2882615Protein Restriction endonuclease BstyI [102472] (1 species)
    local sequence similarity to BglII
  7. 2882616Species Geobacillus stearothermophilus [TaxId:1422] [102473] (4 PDB entries)
  8. 2882622Domain d1vrra_: 1vrr A: [120477]
    automated match to d1sdoa_
    protein/DNA complex

Details for d1vrra_

PDB Entry: 1vrr (more details), 2.7 Å

PDB Description: crystal structure of the restriction endonuclease bstyi complex with dna
PDB Compounds: (A:) BstYI

SCOPe Domain Sequences for d1vrra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vrra_ c.52.1.21 (A:) Restriction endonuclease BstyI {Geobacillus stearothermophilus [TaxId: 1422]}
mrivevyshlngleyiqvhlphiweeiqeiivsidaeacrtkeskektkqgqilyspval
neafkekleakgwkesrtnyyvtadpkliretlslepeeqkkvieaagkealksynqtdf
vkdrvaievqfgkysfvaydlfvkhmafyvsdkidvgveilpmkelskemssgisyyege
lynvirqgrgvpavplvligiap

SCOPe Domain Coordinates for d1vrra_:

Click to download the PDB-style file with coordinates for d1vrra_.
(The format of our PDB-style files is described here.)

Timeline for d1vrra_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1vrrb_