SCOP 1.73: Domain d1vrpb2: 1vrp B:103-381

Lineage for d1vrpb2 (1vrp B:103-381)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
   duplication: common core consists of two beta-alpha-beta2-alpha repeats

4. Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (5 families)

5. Family d.128.1.2: Guanido kinase catalytic domain [55935] (2 proteins)

6. Protein Creatine kinase, C-terminal domain [55936] (7 species)

7. Species Pacific electric ray (Torpedo californica) [TaxId:7787] [82781] (1 PDB entry)

8. Domain d1vrpb2: 1vrp B:103-381 [120476]
   Other proteins in same PDB: d1vrpa1, d1vrpb1
   automatically matched to d1n16a2
   complexed with adp, iom, mg, no3

Details for d1vrpb2

PDB Entry: 1vrp, 2.1 Å

PDB Description: The 2.1 Structure of T. californica Creatine Kinase Complexed with the Transition-State Analogue Complex, ADP-Mg 2+ /NO3-/Creatine

PDB Compounds: (B:) Creatine kinase, M chain

SCOP Domain Sequences for d1vrpb2:

Sequence; same for both SEQRES and ATOM records:

>d1vrpb2 d.128.1.2 (B:103-381) Creatine kinase, C-terminal domain {Pacific electric ray (Torpedo californica) [TaxId: 7787]}
tdkhktdlnqenlkggddldpnyvlssrvrtgrsikgialpphcsrgerrlveklcidgl
atltgefqgkyyplssmsdaeqqqliddhflfdkpisplllasgmardwpdgrgiwhnnd
ktflvwvneedhlrvismqkggnmkevfrrfcvglkkiedifvkagrgfmwnehlgyvlt
cpsnlgtglrggvhvkiphlckhekfsevlkrtrlqkrgtggvdtaavgsiydisnadrl
gfseveqvqmvvdgvklmvemekrlengksiddlmpaqk

Timeline for d1vrpb2:

• d1vrpb2 is new in SCOP 1.73
  
• d1vrpb2 appears in SCOP 1.75
  
• d1vrpb2 appears in the current release, SCOPe 2.08