Lineage for d1vrpa2 (1vrp A:103-381)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 872298Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 872299Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (5 families) (S)
  5. 872430Family d.128.1.2: Guanido kinase catalytic domain [55935] (2 proteins)
  6. 872441Protein Creatine kinase, C-terminal domain [55936] (7 species)
  7. 872468Species Pacific electric ray (Torpedo californica) [TaxId:7787] [82781] (1 PDB entry)
  8. 872469Domain d1vrpa2: 1vrp A:103-381 [120474]
    Other proteins in same PDB: d1vrpa1, d1vrpb1
    automatically matched to d1n16a2
    complexed with adp, iom, mg, no3

Details for d1vrpa2

PDB Entry: 1vrp (more details), 2.1 Å

PDB Description: The 2.1 Structure of T. californica Creatine Kinase Complexed with the Transition-State Analogue Complex, ADP-Mg 2+ /NO3-/Creatine
PDB Compounds: (A:) Creatine kinase, M chain

SCOP Domain Sequences for d1vrpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vrpa2 d.128.1.2 (A:103-381) Creatine kinase, C-terminal domain {Pacific electric ray (Torpedo californica) [TaxId: 7787]}
tdkhktdlnqenlkggddldpnyvlssrvrtgrsikgialpphcsrgerrlveklcidgl
atltgefqgkyyplssmsdaeqqqliddhflfdkpisplllasgmardwpdgrgiwhnnd
ktflvwvneedhlrvismqkggnmkevfrrfcvglkkiedifvkagrgfmwnehlgyvlt
cpsnlgtglrggvhvkiphlckhekfsevlkrtrlqkrgtggvdtaavgsiydisnadrl
gfseveqvqmvvdgvklmvemekrlengksiddlmpaqk

SCOP Domain Coordinates for d1vrpa2:

Click to download the PDB-style file with coordinates for d1vrpa2.
(The format of our PDB-style files is described here.)

Timeline for d1vrpa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vrpa1