Lineage for d1vrma1 (1vrm A:44-352)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2531295Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 2532025Superfamily d.96.2: ApbE-like [143631] (2 families) (S)
    duplication: contains two differently decorated beta(2)-alpha(2)-beta(2) subdomains, similar to other T-fold domains; probably does not form the tunnel-shaped oligomers
  5. 2532026Family d.96.2.1: ApbE-like [143632] (1 protein)
    Pfam PF02424
  6. 2532027Protein Hypothetical protein TM1553 [143633] (1 species)
  7. 2532028Species Thermotoga maritima [TaxId:2336] [143634] (1 PDB entry)
    Uniprot Q9X1N9 44-352
  8. 2532029Domain d1vrma1: 1vrm A:44-352 [120472]
    complexed with mpd, mrd, unl

Details for d1vrma1

PDB Entry: 1vrm (more details), 1.58 Å

PDB Description: Crystal structure of the apbe protein (tm1553) from thermotoga maritima msb8 at 1.58 A resolution
PDB Compounds: (A:) hypothetical protein TM1553

SCOPe Domain Sequences for d1vrma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vrma1 d.96.2.1 (A:44-352) Hypothetical protein TM1553 {Thermotoga maritima [TaxId: 2336]}
qyyelrdfalgtsvrivvssqkinprtiaeailedmkritykfsftdersvvkkindhpn
ewvevdeetyslikaacafaeltdgafdptvgrllelwgftgnyenlrvpsreeieealk
htgyknvlfddknmrvmvkngvkidlggiakgyaldrarqialsfdenatgfveaggdvr
iigpkfgkypwvigvkdprgddvidyiylksgavatsgdyeryfvvdgvryhhildpstg
ypargvwsvtiiaedattadalstagfvmagkdwrkvvldfpnmgahllivleggaiers
etfklfere

SCOPe Domain Coordinates for d1vrma1:

Click to download the PDB-style file with coordinates for d1vrma1.
(The format of our PDB-style files is described here.)

Timeline for d1vrma1: