Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
Superfamily d.113.1: Nudix [55811] (8 families) |
Family d.113.1.3: MutY C-terminal domain-like [103211] (2 proteins) |
Protein Adenine glycosylase MutY, C-terminal domain [103212] (1 species) |
Species Bacillus stearothermophilus [TaxId:1422] [103213] (5 PDB entries) |
Domain d1vrla2: 1vrl A:234-360 [120471] Other proteins in same PDB: d1vrla1 automated match to d1rrsa2 protein/DNA complex; complexed with ade, ca, sf4 |
PDB Entry: 1vrl (more details), 2.5 Å
SCOPe Domain Sequences for d1vrla2:
Sequence, based on SEQRES records: (download)
>d1vrla2 d.113.1.3 (A:234-360) Adenine glycosylase MutY, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} vkqvplavavladdegrvlirkrdstgllanlwefpscetdgadgkekleqmvgeqyglq veltepivsfehafshlvwqltvfpgrlvhggpveepyrlapedelkayafpvshqrvwr eykewas
>d1vrla2 d.113.1.3 (A:234-360) Adenine glycosylase MutY, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} vkqvplavavladdegrvlirkrdstgllanlwefpscetddgkekleqmvglqveltep ivsfehafshlvwqltvfpgrlvhggpveepyrlapedelkayafpvshqrvwreykewa s
Timeline for d1vrla2: