Lineage for d1vrla2 (1vrl A:231-360)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 871095Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 871096Superfamily d.113.1: Nudix [55811] (7 families) (S)
  5. 871273Family d.113.1.3: MutY C-terminal domain-like [103211] (2 proteins)
  6. 871277Protein Adenine glycosylase MutY, C-terminal domain [103212] (1 species)
  7. 871278Species Bacillus stearothermophilus [TaxId:1422] [103213] (3 PDB entries)
  8. 871281Domain d1vrla2: 1vrl A:231-360 [120471]
    Other proteins in same PDB: d1vrla1
    automatically matched to d1rrta2
    complexed with 8og, ade, ca, hpd, sf4; mutant

Details for d1vrla2

PDB Entry: 1vrl (more details), 2.5 Å

PDB Description: MutY adenine glycosylase in complex with DNA and soaked adenine free base
PDB Compounds: (A:) MutY

SCOP Domain Sequences for d1vrla2:

Sequence, based on SEQRES records: (download)

>d1vrla2 d.113.1.3 (A:231-360) Adenine glycosylase MutY, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]}
ktavkqvplavavladdegrvlirkrdstgllanlwefpscetdgadgkekleqmvgeqy
glqveltepivsfehafshlvwqltvfpgrlvhggpveepyrlapedelkayafpvshqr
vwreykewas

Sequence, based on observed residues (ATOM records): (download)

>d1vrla2 d.113.1.3 (A:231-360) Adenine glycosylase MutY, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]}
ktavkqvplavavladdegrvlirkrdstgllanlwefpscetddgkekleqmvglqvel
tepivsfehafshlvwqltvfpgrlvhggpveepyrlapedelkayafpvshqrvwreyk
ewas

SCOP Domain Coordinates for d1vrla2:

Click to download the PDB-style file with coordinates for d1vrla2.
(The format of our PDB-style files is described here.)

Timeline for d1vrla2: