Lineage for d1vrla1 (1vrl A:9-230)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2334077Fold a.96: DNA-glycosylase [48149] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2334078Superfamily a.96.1: DNA-glycosylase [48150] (7 families) (S)
  5. 2334086Family a.96.1.2: Mismatch glycosylase [48154] (4 proteins)
  6. 2334087Protein Catalytic domain of MutY [48155] (2 species)
  7. 2334088Species Bacillus stearothermophilus [TaxId:1422] [101348] (5 PDB entries)
  8. 2334091Domain d1vrla1: 1vrl A:9-230 [120470]
    Other proteins in same PDB: d1vrla2
    automated match to d1rrsa1
    protein/DNA complex; complexed with ade, ca, sf4

Details for d1vrla1

PDB Entry: 1vrl (more details), 2.5 Å

PDB Description: MutY adenine glycosylase in complex with DNA and soaked adenine free base
PDB Compounds: (A:) MutY

SCOPe Domain Sequences for d1vrla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vrla1 a.96.1.2 (A:9-230) Catalytic domain of MutY {Bacillus stearothermophilus [TaxId: 1422]}
parefqrdlldwfarerrdlpwrkdrdpykvwvsevmlqqtrvetvipyfeqfidrfptl
ealadadedevlkaweglgyysrvrnlhaavkevktryggkvpddpdefsrlkgvgpytv
gavlslaygvpepavngnvmrvlsrlflvtddiakpstrkrfeqivreimayenpgafne
alielgalvctprrpscllcpvqaycqafaegvaeelpvkmk

SCOPe Domain Coordinates for d1vrla1:

Click to download the PDB-style file with coordinates for d1vrla1.
(The format of our PDB-style files is described here.)

Timeline for d1vrla1: