SCOP 1.73: Domain d1vrla1: 1vrl A:9-230

Lineage for d1vrla1 (1vrl A:9-230)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.96: DNA-glycosylase [48149] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.96.1: DNA-glycosylase [48150] (6 families)

5. Family a.96.1.2: Mismatch glycosylase [48154] (3 proteins)

6. Protein Catalytic domain of MutY [48155] (2 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [101348] (3 PDB entries)

8. Domain d1vrla1: 1vrl A:9-230 [120470]
   Other proteins in same PDB: d1vrla2
   automatically matched to d1rrsa1
   complexed with 8og, ade, ca, hpd, sf4; mutant

Details for d1vrla1

PDB Entry: 1vrl, 2.5 Å

PDB Description: MutY adenine glycosylase in complex with DNA and soaked adenine free base

PDB Compounds: (A:) MutY

SCOP Domain Sequences for d1vrla1:

Sequence; same for both SEQRES and ATOM records:

>d1vrla1 a.96.1.2 (A:9-230) Catalytic domain of MutY {Bacillus stearothermophilus [TaxId: 1422]}
parefqrdlldwfarerrdlpwrkdrdpykvwvsevmlqqtrvetvipyfeqfidrfptl
ealadadedevlkaweglgyysrvrnlhaavkevktryggkvpddpdefsrlkgvgpytv
gavlslaygvpepavngnvmrvlsrlflvtddiakpstrkrfeqivreimayenpgafne
alielgalvctprrpscllcpvqaycqafaegvaeelpvkmk

Timeline for d1vrla1:

• d1vrla1 is new in SCOP 1.73
  
• d1vrla1 appears in SCOP 1.75
  
• d1vrla1 appears in the current release, SCOPe 2.08