SCOPe 2.08: Domain d1vrge1: 1vrg E:1-251

Lineage for d1vrge1 (1vrg E:1-251)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (9 proteins)
   Pfam PF01039
   the active site is formed by two different homologous subunits or domains of this fold

6. Protein Propionyl-CoA carboxylase complex B subunit, PccB [117466] (3 species)

7. Species Thermotoga maritima [TaxId:2336] [142011] (1 PDB entry)
   Uniprot Q9WZH5 1-251! Uniprot Q9WZH5 252-515

8. Domain d1vrge1: 1vrg E:1-251 [120466]
   automated match to d1vrga1
   complexed with bct, mg

Details for d1vrge1

PDB Entry: 1vrg, 2.3 Å

PDB Description: crystal structure of propionyl-coa carboxylase, beta subunit (tm0716) from thermotoga maritima at 2.30 a resolution

PDB Compounds: (E:) propionyl-CoA carboxylase, beta subunit

SCOPe Domain Sequences for d1vrge1:

Sequence; same for both SEQRES and ATOM records:

>d1vrge1 c.14.1.4 (E:1-251) Propionyl-CoA carboxylase complex B subunit, PccB {Thermotoga maritima [TaxId: 2336]}
mslrdkieelkkiekeieqgggpekvekqhragkltawerlellldpgtfveidkfvehr
ntyfgldkvklprdgvitgvgeingrkvavfsqdftvmggslgemhakkivklldlalkm
gipvigindsggariqegvdalagygeiflrntlasgvvpqitviagpcaggavyspalt
dfivmvdqtarmfitgpnvikavtgeeisqedlggamvhnqksgnahfladndekamslv
rtllsylpsnn

Timeline for d1vrge1:

• d1vrge1 first appeared in SCOP 1.73
  
• d1vrge1 appears in SCOPe 2.07