Lineage for d1vrgd2 (1vrg D:252-515)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1353895Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 1353896Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 1354508Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (7 proteins)
    Pfam PF01039
    the active site is formed by two different homologous subunits or domains of this fold
  6. 1354610Protein Propionyl-CoA carboxylase complex B subunit, PccB [117466] (3 species)
  7. 1354657Species Thermotoga maritima [TaxId:2336] [142011] (1 PDB entry)
    Uniprot Q9WZH5 1-251! Uniprot Q9WZH5 252-515
  8. 1354665Domain d1vrgd2: 1vrg D:252-515 [120465]
    automated match to d1vrga2
    complexed with bct, mg

Details for d1vrgd2

PDB Entry: 1vrg (more details), 2.3 Å

PDB Description: crystal structure of propionyl-coa carboxylase, beta subunit (tm0716) from thermotoga maritima at 2.30 a resolution
PDB Compounds: (D:) propionyl-CoA carboxylase, beta subunit

SCOPe Domain Sequences for d1vrgd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vrgd2 c.14.1.4 (D:252-515) Propionyl-CoA carboxylase complex B subunit, PccB {Thermotoga maritima [TaxId: 2336]}
aeeppvedpdtsletpedildilpdnpnkgydvrdvikrvvdhgeffevqpyfaknivig
fariqgktvgivanqpsvlagvldidssdkaarfirfldafnipiltfvdtpgylpgvaq
ehggiirhgakllyayseatvpkitvilrkayggayiamgskhlgadmvlawpsaeiavm
gpegaaniifkreieassnpeetrrklieeykqqfanpyiaasrgyvdmvidpretrkyi
mralevcetkveyrpkkkhgnipl

SCOPe Domain Coordinates for d1vrgd2:

Click to download the PDB-style file with coordinates for d1vrgd2.
(The format of our PDB-style files is described here.)

Timeline for d1vrgd2: