SCOP 1.75: Domain d1vrga2: 1vrg A:252-515

Lineage for d1vrga2 (1vrg A:252-515)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (4 families)

5. Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (6 proteins)
   Pfam PF01039
   the active site is formed by two different homologous subunits or domains of this fold

6. Protein Propionyl-CoA carboxylase complex B subunit, PccB [117466] (3 species)

7. Species Thermotoga maritima [TaxId:2336] [142011] (1 PDB entry)
   Uniprot Q9WZH5 1-251! Uniprot Q9WZH5 252-515

8. Domain d1vrga2: 1vrg A:252-515 [120459]
   complexed with bct, mg

Details for d1vrga2

PDB Entry: 1vrg, 2.3 Å

PDB Description: crystal structure of propionyl-coa carboxylase, beta subunit (tm0716) from thermotoga maritima at 2.30 a resolution

PDB Compounds: (A:) propionyl-CoA carboxylase, beta subunit

SCOP Domain Sequences for d1vrga2:

Sequence; same for both SEQRES and ATOM records:

>d1vrga2 c.14.1.4 (A:252-515) Propionyl-CoA carboxylase complex B subunit, PccB {Thermotoga maritima [TaxId: 2336]}
aeeppvedpdtsletpedildilpdnpnkgydvrdvikrvvdhgeffevqpyfaknivig
fariqgktvgivanqpsvlagvldidssdkaarfirfldafnipiltfvdtpgylpgvaq
ehggiirhgakllyayseatvpkitvilrkayggayiamgskhlgadmvlawpsaeiavm
gpegaaniifkreieassnpeetrrklieeykqqfanpyiaasrgyvdmvidpretrkyi
mralevcetkveyrpkkkhgnipl

Timeline for d1vrga2:

• d1vrga2 first appeared in SCOP 1.73
  
• d1vrga2 appears in SCOPe 2.01
  
• d1vrga2 appears in the current release, SCOPe 2.08