Lineage for d1vrcd1 (1vrc D:201-285)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 730020Fold d.94: HPr-like [55593] (2 superfamilies)
    beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423
  4. 730021Superfamily d.94.1: HPr-like [55594] (1 family) (S)
  5. 730022Family d.94.1.1: HPr-like [55595] (2 proteins)
  6. 730034Protein Histidine-containing phosphocarrier protein (HPr) [55596] (7 species)
  7. 730060Species Escherichia coli [TaxId:562] [55599] (13 PDB entries)
  8. 730068Domain d1vrcd1: 1vrc D:201-285 [120457]
    Other proteins in same PDB: d1vrca1, d1vrcb1
    automatically matched to d1ggrb_
    complexed with po3

Details for d1vrcd1

PDB Entry: 1vrc (more details)

PDB Description: complex of enzyme iiamannose and the histidine-containing phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure
PDB Compounds: (D:) Phosphocarrier protein HPr

SCOP Domain Sequences for d1vrcd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vrcd1 d.94.1.1 (D:201-285) Histidine-containing phosphocarrier protein (HPr) {Escherichia coli [TaxId: 562]}
mfqqevtitapnglhtrpaaqfvkeakgftseitvtsngksasakslfklqtlgltqgtv
vtisaegedeqkavehlvklmaele

SCOP Domain Coordinates for d1vrcd1:

Click to download the PDB-style file with coordinates for d1vrcd1.
(The format of our PDB-style files is described here.)

Timeline for d1vrcd1: