Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.54: PTS system fructose IIA component-like [53061] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest |
Superfamily c.54.1: PTS system fructose IIA component-like [53062] (3 families) active dimer is formed by strand 5 swapping |
Family c.54.1.0: automated matches [191356] (1 protein) not a true family |
Protein automated matches [190395] (8 species) not a true protein |
Species Escherichia coli [TaxId:562] [254922] (1 PDB entry) |
Domain d1vrcb_: 1vrc B: [120455] Other proteins in same PDB: d1vrcc_, d1vrcd_ automated match to d3lfhe_ |
PDB Entry: 1vrc (more details)
SCOPe Domain Sequences for d1vrcb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vrcb_ c.54.1.0 (B:) automated matches {Escherichia coli [TaxId: 562]} tiaivigthgwaaeqllktaemllgeqenvgwidfvpgenaetliekynaqlakldttkg vlflvdtwggspfnaasrivvdkehyeviagvnipmlvetlmardddpsfdelvalavet gregvkalk
Timeline for d1vrcb_: