SCOPe 2.07: Domain d1vrcb_: 1vrc B:

Lineage for d1vrcb_ (1vrc B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.54: PTS system fructose IIA component-like [53061] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest

4. Superfamily c.54.1: PTS system fructose IIA component-like [53062] (3 families)
   active dimer is formed by strand 5 swapping

5. Family c.54.1.0: automated matches [191356] (1 protein)
   not a true family

6. Protein automated matches [190395] (8 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [254922] (1 PDB entry)

8. Domain d1vrcb_: 1vrc B: [120455]
   Other proteins in same PDB: d1vrcc_, d1vrcd_
   automated match to d3lfhe_

Details for d1vrcb_

PDB Entry: 1vrc

PDB Description: complex of enzyme iiamannose and the histidine-containing phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure

PDB Compounds: (B:) PTS system, mannose-specific IIAB component

SCOPe Domain Sequences for d1vrcb_:

Sequence; same for both SEQRES and ATOM records:

>d1vrcb_ c.54.1.0 (B:) automated matches {Escherichia coli [TaxId: 562]}
tiaivigthgwaaeqllktaemllgeqenvgwidfvpgenaetliekynaqlakldttkg
vlflvdtwggspfnaasrivvdkehyeviagvnipmlvetlmardddpsfdelvalavet
gregvkalk

Timeline for d1vrcb_:

• d1vrcb_ first appeared in SCOP 1.73, called d1vrcb1
  
• d1vrcb_ appears in SCOPe 2.06
  
• d1vrcb_ appears in the current release, SCOPe 2.08