![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.54: IIA domain of mannose transporter, IIA-Man [53061] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest |
![]() | Superfamily c.54.1: IIA domain of mannose transporter, IIA-Man [53062] (1 family) ![]() active dimer is formed by strand 5 swapping |
![]() | Family c.54.1.1: IIA domain of mannose transporter, IIA-Man [53063] (1 protein) |
![]() | Protein IIA domain of mannose transporter, IIA-Man [53064] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [53065] (2 PDB entries) |
![]() | Domain d1vrcb1: 1vrc B:2-130 [120455] Other proteins in same PDB: d1vrcc1, d1vrcd1 automatically matched to d1pdo__ complexed with po3 |
PDB Entry: 1vrc (more details)
SCOP Domain Sequences for d1vrcb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vrcb1 c.54.1.1 (B:2-130) IIA domain of mannose transporter, IIA-Man {Escherichia coli [TaxId: 562]} tiaivigthgwaaeqllktaemllgeqenvgwidfvpgenaetliekynaqlakldttkg vlflvdtwggspfnaasrivvdkehyeviagvnipmlvetlmardddpsfdelvalavet gregvkalk
Timeline for d1vrcb1: