Lineage for d1vrcb_ (1vrc B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883312Fold c.54: PTS system fructose IIA component-like [53061] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest
  4. 2883313Superfamily c.54.1: PTS system fructose IIA component-like [53062] (3 families) (S)
    active dimer is formed by strand 5 swapping
  5. 2883344Family c.54.1.0: automated matches [191356] (1 protein)
    not a true family
  6. 2883345Protein automated matches [190395] (8 species)
    not a true protein
  7. 2883355Species Escherichia coli [TaxId:562] [254922] (1 PDB entry)
  8. 2883357Domain d1vrcb_: 1vrc B: [120455]
    Other proteins in same PDB: d1vrcc_, d1vrcd_
    automated match to d3lfhe_
    complexed with po3

Details for d1vrcb_

PDB Entry: 1vrc (more details)

PDB Description: complex of enzyme iiamannose and the histidine-containing phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure
PDB Compounds: (B:) PTS system, mannose-specific IIAB component

SCOPe Domain Sequences for d1vrcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vrcb_ c.54.1.0 (B:) automated matches {Escherichia coli [TaxId: 562]}
tiaivigthgwaaeqllktaemllgeqenvgwidfvpgenaetliekynaqlakldttkg
vlflvdtwggspfnaasrivvdkehyeviagvnipmlvetlmardddpsfdelvalavet
gregvkalk

SCOPe Domain Coordinates for d1vrcb_:

Click to download the PDB-style file with coordinates for d1vrcb_.
(The format of our PDB-style files is described here.)

Timeline for d1vrcb_: