SCOPe 2.01: Domain d1vr7b_: 1vr7 B:

Lineage for d1vr7b_ (1vr7 B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.156: S-adenosylmethionine decarboxylase [56275] (1 superfamily)
   duplication of beta-alpha-beta(4)-alpha-beta-alpha-beta(2) motif; 4 layers a/b/b/a; antiparallel beta-sheets: order 23451687

4. Superfamily d.156.1: S-adenosylmethionine decarboxylase [56276] (3 families)

5. Family d.156.1.2: Bacterial S-adenosylmethionine decarboxylase [111222] (2 proteins)
   Pfam PF02675;homodimer; the subunit fold and assembly are similar to those of the structural repeats of the eukaryotic enzyme

6. Protein automated matches [190084] (1 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:2336] [186805] (1 PDB entry)

8. Domain d1vr7b_: 1vr7 B: [120444]
   automated match to d1tlua_
   complexed with edo

Details for d1vr7b_

PDB Entry: 1vr7, 1.2 Å

PDB Description: crystal structure of s-adenosylmethionine decarboxylase proenzyme (tm0655) from thermotoga maritima at 1.2 a resolution

PDB Compounds: (B:) s-adenosylmethionine decarboxylase proenzyme

SCOPe Domain Sequences for d1vr7b_:

Sequence; same for both SEQRES and ATOM records:

>d1vr7b_ d.156.1.2 (B:) automated matches {Thermotoga maritima [TaxId: 2336]}
mkslgrhlvaefyecdrevldnvqlieqemkqaayesgativtstfhrflpygvsgvvvi
seshltihtwpeygyaaidlftcgedvdpwkafehlkkalkakrvhvvehergrydei

Timeline for d1vr7b_:

• d1vr7b_ first appeared in SCOP 1.73, called d1vr7b1
  
• d1vr7b_ was called d1vr7b1 in SCOP 1.75
  
• d1vr7b_ appears in SCOPe 2.02
  
• d1vr7b_ appears in the current release, SCOPe 2.08