Lineage for d1vr7b1 (1vr7 B:2-118)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 736588Fold d.156: S-adenosylmethionine decarboxylase [56275] (1 superfamily)
    duplication of beta-alpha-beta(4)-alpha-beta-alpha-beta(2) motif; 4 layers a/b/b/a; antiparallel beta-sheets: order 23451687
  4. 736589Superfamily d.156.1: S-adenosylmethionine decarboxylase [56276] (2 families) (S)
  5. 736607Family d.156.1.2: Bacterial S-adenosylmethionine decarboxylase [111222] (1 protein)
    Pfam PF02675;homodimer; the subunit fold and assembly are similar to those of the structural repeats of the eukaryotic enzyme
  6. 736608Protein S-adenosylmethionine decarboxylase (SamDC, SpeH) [111223] (1 species)
  7. 736609Species Thermotoga maritima [TaxId:2336] [111224] (3 PDB entries)
  8. 736611Domain d1vr7b1: 1vr7 B:2-118 [120444]
    automatically matched to d1tlua_
    complexed with edo

Details for d1vr7b1

PDB Entry: 1vr7 (more details), 1.2 Å

PDB Description: crystal structure of s-adenosylmethionine decarboxylase proenzyme (tm0655) from thermotoga maritima at 1.2 a resolution
PDB Compounds: (B:) s-adenosylmethionine decarboxylase proenzyme

SCOP Domain Sequences for d1vr7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vr7b1 d.156.1.2 (B:2-118) S-adenosylmethionine decarboxylase (SamDC, SpeH) {Thermotoga maritima [TaxId: 2336]}
kslgrhlvaefyecdrevldnvqlieqemkqaayesgativtstfhrflpygvsgvvvis
eshltihtwpeygyaaidlftcgedvdpwkafehlkkalkakrvhvvehergrydei

SCOP Domain Coordinates for d1vr7b1:

Click to download the PDB-style file with coordinates for d1vr7b1.
(The format of our PDB-style files is described here.)

Timeline for d1vr7b1: