Lineage for d1vr6b2 (1vr6 B:1-338)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2086072Family c.1.10.4: Class I DAHP synthetase [51599] (3 protein domains)
  6. 2086269Protein automated matches [190083] (8 species)
    not a true protein
  7. 2086365Species Thermotoga maritima [TaxId:2336] [186804] (3 PDB entries)
  8. 2086367Domain d1vr6b2: 1vr6 B:1-338 [120440]
    Other proteins in same PDB: d1vr6a3, d1vr6b3, d1vr6c3, d1vr6d3
    automated match to d1rzma_

Details for d1vr6b2

PDB Entry: 1vr6 (more details), 1.92 Å

PDB Description: Crystal structure of Phospho-2-dehydro-3-deoxyheptonate aldolase (DAHP synthase) (TM0343) from Thermotoga Maritima at 1.92 A resolution
PDB Compounds: (B:) phospho-2-dehydro-3-deoxyheptonate aldolase

SCOPe Domain Sequences for d1vr6b2:

Sequence, based on SEQRES records: (download)

>d1vr6b2 c.1.10.4 (B:1-338) automated matches {Thermotoga maritima [TaxId: 2336]}
mivvlkpgsteedirkvvklaesynlkchiskgqertvigiigddryvvadkfesldcve
svvrvlkpyklvsrefhpedtvidlgdvkigngyftiiagpcsvegremlmetahflsel
gvkvlrggaykprtspysfqglgekgleylreaadkygmyvvtealgeddlpkvaeyadi
iqigarnaqnfrllskagsynkpvllkrgfmntieefllsaeyiansgntkiilcergir
tfekatrntldisavpiirkeshlpilvdpshsggrrdlviplsraaiavgahgiivevh
pepekalsdgkqsldfelfkelvqemkkladalgvkvn

Sequence, based on observed residues (ATOM records): (download)

>d1vr6b2 c.1.10.4 (B:1-338) automated matches {Thermotoga maritima [TaxId: 2336]}
mivvlkpgsteedirkvvklaesynlkchiskgqertvigiigddryvvadkfesldcve
svvrvlkpyklvsrefhpedtvidlgdvkigngyftiiagpcsvegremlmetahflsel
gvkvlrggaykprsfqglgekgleylreaadkygmyvvtealgeddlpkvaeyadiiqig
arnaqnfrllskagsynkpvllkrgfmntieefllsaeyiansgntkiilcergirtfek
atrntldisavpiirkeshlpilvdpshsggrrdlviplsraaiavgahgiivevhpepe
kalsdgkqsldfelfkelvqemkkladalgvkvn

SCOPe Domain Coordinates for d1vr6b2:

Click to download the PDB-style file with coordinates for d1vr6b2.
(The format of our PDB-style files is described here.)

Timeline for d1vr6b2: