Lineage for d1vr6a_ (1vr6 A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1342158Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1342981Family c.1.10.4: Class I DAHP synthetase [51599] (3 proteins)
  6. 1343178Protein automated matches [190083] (7 species)
    not a true protein
  7. 1343274Species Thermotoga maritima [TaxId:2336] [186804] (3 PDB entries)
  8. 1343275Domain d1vr6a_: 1vr6 A: [120439]
    automated match to d1rzma_

Details for d1vr6a_

PDB Entry: 1vr6 (more details), 1.92 Å

PDB Description: Crystal structure of Phospho-2-dehydro-3-deoxyheptonate aldolase (DAHP synthase) (TM0343) from Thermotoga Maritima at 1.92 A resolution
PDB Compounds: (A:) phospho-2-dehydro-3-deoxyheptonate aldolase

SCOPe Domain Sequences for d1vr6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vr6a_ c.1.10.4 (A:) automated matches {Thermotoga maritima [TaxId: 2336]}
hhhhhmivvlkpgsteedirkvvklaesynlkchiskgqertvigiigddryvvadkfes
ldcvesvvrvlkpyklvsrefhpedtvidlgdvkigngyftiiagpcsvegremlmetah
flselgvkvlrggaykprtspysfqglgekgleylreaadkygmyvvtealgeddlpkva
eyadiiqigarnaqnfrllskagsynkpvllkrgfmntieefllsaeyiansgntkiilc
ergirtfekatrntldisavpiirkeshlpilvdpshsggrrdlviplsraaiavgahgi
ivevhpepekalsdgkqsldfelfkelvqemkkladalgvkvn

SCOPe Domain Coordinates for d1vr6a_:

Click to download the PDB-style file with coordinates for d1vr6a_.
(The format of our PDB-style files is described here.)

Timeline for d1vr6a_: