SCOP 1.73: Domain d1vr5b1: 1vr5 B:23-557

Lineage for d1vr5b1 (1vr5 B:23-557)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (35 proteins)

6. Protein Oligo-peptide binding protein (OPPA) [53852] (3 species)
   contains an additional alpha+beta domain inserted in the N-terminal domain

7. Species Thermotoga maritima [TaxId:2336] [142800] (1 PDB entry)
   TM1223

8. Domain d1vr5b1: 1vr5 B:23-557 [120438]
   automatically matched to 1VR5 A:23-557
   complexed with act, cl, edo, epe, fmt, na

Details for d1vr5b1

PDB Entry: 1vr5, 1.73 Å

PDB Description: crystal structure of oligopeptide abc transporter, periplasmic oligopeptide-binding (tm1223) from thermotoga maritima at 1.73 a resolution

PDB Compounds: (B:) oligopeptide ABC transporter, periplasmic oligopeptide-binding protein

SCOP Domain Sequences for d1vr5b1:

Sequence; same for both SEQRES and ATOM records:

>d1vr5b1 c.94.1.1 (B:23-557) Oligo-peptide binding protein (OPPA) {Thermotoga maritima [TaxId: 2336]}
ernktlywggalwsppsnwnpftpwnavagtiglvyeplflydplndkfepwlaekgewv
snneyvltlrkglrwqdgvpltaddvvftfeiakkytgisyspvwnwlgriervdertlk
fvfsdpryqewkqmlintpivpkhiwenkteeevlqaanenpvgsgpyyveswaddrcvf
kkngnwwgirelgydpkperivelrvlsnnvavgmlmkgeldwsnfflpgvpvlkkaygi
vtwyenapymlpantagiyinvnkyplsipefrramayainpekivtrayenmvtaanpa
gilplpgymkyypkevvdkygfkydpemakkildelgfkdvnkdgfredpngkpfkltie
cpygwtdwmvsiqsiaedlvkvginvepkypdyskyaddlyggkfdlilnnfttgvsati
wsyfngvfypdaveseysysgnfgkyanpevetlldelnrsnddakikevvaklseillk
dlpfiplwyngawfqaseavwtnwpteknpyavpigwngwwqltgiktlfgieak

Timeline for d1vr5b1:

• d1vr5b1 is new in SCOP 1.73
  
• d1vr5b1 appears in SCOP 1.75
  
• d1vr5b1 appears in the current release, SCOPe 2.08, called d1vr5b2