Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) |
Protein Oligo-peptide binding protein (OPPA) [53852] (3 species) contains an additional alpha+beta domain inserted in the N-terminal domain |
Species Thermotoga maritima [TaxId:2336] [142800] (3 PDB entries) Uniprot Q9X0V0 23-557 TM1223 |
Domain d1vr5a1: 1vr5 A:23-557 [120437] Other proteins in same PDB: d1vr5a2, d1vr5b3 complexed with act, cl, edo, epe, fmt, na |
PDB Entry: 1vr5 (more details), 1.73 Å
SCOPe Domain Sequences for d1vr5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vr5a1 c.94.1.1 (A:23-557) Oligo-peptide binding protein (OPPA) {Thermotoga maritima [TaxId: 2336]} ernktlywggalwsppsnwnpftpwnavagtiglvyeplflydplndkfepwlaekgewv snneyvltlrkglrwqdgvpltaddvvftfeiakkytgisyspvwnwlgriervdertlk fvfsdpryqewkqmlintpivpkhiwenkteeevlqaanenpvgsgpyyveswaddrcvf kkngnwwgirelgydpkperivelrvlsnnvavgmlmkgeldwsnfflpgvpvlkkaygi vtwyenapymlpantagiyinvnkyplsipefrramayainpekivtrayenmvtaanpa gilplpgymkyypkevvdkygfkydpemakkildelgfkdvnkdgfredpngkpfkltie cpygwtdwmvsiqsiaedlvkvginvepkypdyskyaddlyggkfdlilnnfttgvsati wsyfngvfypdaveseysysgnfgkyanpevetlldelnrsnddakikevvaklseillk dlpfiplwyngawfqaseavwtnwpteknpyavpigwngwwqltgiktlfgieak
Timeline for d1vr5a1: