SCOPe 2.01: Domain d1vr4d_: 1vr4 D:

Lineage for d1vr4d_ (1vr4 D:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.230: Dodecin subunit-like [88797] (6 superfamilies)
   beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132

4. Superfamily d.230.5: YbjQ-like [117782] (2 families)
   pentamer, beta/alpha-propeller; additional short beta-strands promote oligomeric assembly

5. Family d.230.5.0: automated matches [191317] (1 protein)
   not a true family

6. Protein automated matches [190082] (1 species)
   not a true protein

7. Species Bacillus cereus [TaxId:226900] [186803] (1 PDB entry)

8. Domain d1vr4d_: 1vr4 D: [120435]
   Other proteins in same PDB: d1vr4a1
   automated match to d1y2ia_

Details for d1vr4d_

PDB Entry: 1vr4, 2.09 Å

PDB Description: crystal structure of mcsg target apc22750 from bacillus cereus

PDB Compounds: (D:) hypothetical protein APC22750

SCOPe Domain Sequences for d1vr4d_:

Sequence; same for both SEQRES and ATOM records:

>d1vr4d_ d.230.5.0 (D:) automated matches {Bacillus cereus [TaxId: 226900]}
mivtttsgiqgkeiieyidivngeaimganivrdlfasvrdvvggragsyesklkeardi
amdemkelakqkganaivgvdvdyevvrdgmlmvavsgtavri

Timeline for d1vr4d_:

• d1vr4d_ first appeared in SCOP 1.73, called d1vr4d1
  
• d1vr4d_ was called d1vr4d1 in SCOP 1.75
  
• d1vr4d_ appears in SCOPe 2.02
  
• d1vr4d_ appears in the current release, SCOPe 2.08