Lineage for d1vr4d_ (1vr4 D:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1051631Fold d.230: Dodecin subunit-like [88797] (6 superfamilies)
    beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132
  4. 1051802Superfamily d.230.5: YbjQ-like [117782] (2 families) (S)
    pentamer, beta/alpha-propeller; additional short beta-strands promote oligomeric assembly
  5. 1051821Family d.230.5.0: automated matches [191317] (1 protein)
    not a true family
  6. 1051822Protein automated matches [190082] (1 species)
    not a true protein
  7. 1051823Species Bacillus cereus [TaxId:226900] [186803] (1 PDB entry)
  8. 1051826Domain d1vr4d_: 1vr4 D: [120435]
    Other proteins in same PDB: d1vr4a1
    automated match to d1y2ia_

Details for d1vr4d_

PDB Entry: 1vr4 (more details), 2.09 Å

PDB Description: crystal structure of mcsg target apc22750 from bacillus cereus
PDB Compounds: (D:) hypothetical protein APC22750

SCOPe Domain Sequences for d1vr4d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vr4d_ d.230.5.0 (D:) automated matches {Bacillus cereus [TaxId: 226900]}
mivtttsgiqgkeiieyidivngeaimganivrdlfasvrdvvggragsyesklkeardi
amdemkelakqkganaivgvdvdyevvrdgmlmvavsgtavri

SCOPe Domain Coordinates for d1vr4d_:

Click to download the PDB-style file with coordinates for d1vr4d_.
(The format of our PDB-style files is described here.)

Timeline for d1vr4d_: