![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.230: Dodecin subunit-like [88797] (6 superfamilies) beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132 |
![]() | Superfamily d.230.5: YbjQ-like [117782] (2 families) ![]() pentamer, beta/alpha-propeller; additional short beta-strands promote oligomeric assembly |
![]() | Family d.230.5.0: automated matches [191317] (1 protein) not a true family |
![]() | Protein automated matches [190082] (1 species) not a true protein |
![]() | Species Bacillus cereus [TaxId:226900] [186803] (1 PDB entry) |
![]() | Domain d1vr4b_: 1vr4 B: [120433] Other proteins in same PDB: d1vr4a1 automated match to d1y2ia_ |
PDB Entry: 1vr4 (more details), 2.09 Å
SCOPe Domain Sequences for d1vr4b_:
Sequence, based on SEQRES records: (download)
>d1vr4b_ d.230.5.0 (B:) automated matches {Bacillus cereus [TaxId: 226900]} mivtttsgiqgkeiieyidivngeaimganivrdlfasvrdvvggragsyesklkeardi amdemkelakqkganaivgvdvdyevvrdgmlmvavsgtavri
>d1vr4b_ d.230.5.0 (B:) automated matches {Bacillus cereus [TaxId: 226900]} mivtttsgiqgkeiieyidivngeaimgaesklkeardiamdemkelakqkganaivgvd vdyevvrdgmlmvavsgtavri
Timeline for d1vr4b_:
![]() Domains from other chains: (mouse over for more information) d1vr4a1, d1vr4c_, d1vr4d_, d1vr4e_ |