Lineage for d1vr4b_ (1vr4 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3007999Fold d.230: Dodecin subunit-like [88797] (9 superfamilies)
    beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132
  4. 3008222Superfamily d.230.5: YbjQ-like [117782] (2 families) (S)
    pentamer, beta/alpha-propeller; additional short beta-strands promote oligomeric assembly
  5. 3008245Family d.230.5.0: automated matches [191317] (1 protein)
    not a true family
  6. 3008246Protein automated matches [190082] (1 species)
    not a true protein
  7. 3008247Species Bacillus cereus [TaxId:226900] [186803] (1 PDB entry)
  8. 3008248Domain d1vr4b_: 1vr4 B: [120433]
    Other proteins in same PDB: d1vr4a1
    automated match to d1y2ia_

Details for d1vr4b_

PDB Entry: 1vr4 (more details), 2.09 Å

PDB Description: crystal structure of mcsg target apc22750 from bacillus cereus
PDB Compounds: (B:) hypothetical protein APC22750

SCOPe Domain Sequences for d1vr4b_:

Sequence, based on SEQRES records: (download)

>d1vr4b_ d.230.5.0 (B:) automated matches {Bacillus cereus [TaxId: 226900]}
mivtttsgiqgkeiieyidivngeaimganivrdlfasvrdvvggragsyesklkeardi
amdemkelakqkganaivgvdvdyevvrdgmlmvavsgtavri

Sequence, based on observed residues (ATOM records): (download)

>d1vr4b_ d.230.5.0 (B:) automated matches {Bacillus cereus [TaxId: 226900]}
mivtttsgiqgkeiieyidivngeaimgaesklkeardiamdemkelakqkganaivgvd
vdyevvrdgmlmvavsgtavri

SCOPe Domain Coordinates for d1vr4b_:

Click to download the PDB-style file with coordinates for d1vr4b_.
(The format of our PDB-style files is described here.)

Timeline for d1vr4b_: