Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.230: Dodecin subunit-like [88797] (6 superfamilies) beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132 |
Superfamily d.230.5: YbjQ-like [117782] (2 families) pentamer, beta/alpha-propeller; additional short beta-strands promote oligomeric assembly |
Family d.230.5.1: YbjQ-like [117783] (3 proteins) Pfam PF01906; DUF 74, UPF0145 |
Protein Hypothetical protein BC1012 [142892] (1 species) |
Species Bacillus cereus [TaxId:1396] [142893] (1 PDB entry) Uniprot Q81H14 1-103 |
Domain d1vr4a1: 1vr4 A:1-103 [120432] Other proteins in same PDB: d1vr4b_, d1vr4c_, d1vr4d_, d1vr4e_ |
PDB Entry: 1vr4 (more details), 2.09 Å
SCOPe Domain Sequences for d1vr4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vr4a1 d.230.5.1 (A:1-103) Hypothetical protein BC1012 {Bacillus cereus [TaxId: 1396]} mivtttsgiqgkeiieyidivngeaimganivrdlfasvrdvvggragsyesklkeardi amdemkelakqkganaivgvdvdyevvrdgmlmvavsgtavri
Timeline for d1vr4a1:
View in 3D Domains from other chains: (mouse over for more information) d1vr4b_, d1vr4c_, d1vr4d_, d1vr4e_ |