Lineage for d1vr4a1 (1vr4 A:1-103)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1051631Fold d.230: Dodecin subunit-like [88797] (6 superfamilies)
    beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132
  4. 1051802Superfamily d.230.5: YbjQ-like [117782] (2 families) (S)
    pentamer, beta/alpha-propeller; additional short beta-strands promote oligomeric assembly
  5. 1051803Family d.230.5.1: YbjQ-like [117783] (3 proteins)
    Pfam PF01906; DUF 74, UPF0145
  6. 1051804Protein Hypothetical protein BC1012 [142892] (1 species)
  7. 1051805Species Bacillus cereus [TaxId:1396] [142893] (1 PDB entry)
    Uniprot Q81H14 1-103
  8. 1051806Domain d1vr4a1: 1vr4 A:1-103 [120432]
    Other proteins in same PDB: d1vr4b_, d1vr4c_, d1vr4d_, d1vr4e_

Details for d1vr4a1

PDB Entry: 1vr4 (more details), 2.09 Å

PDB Description: crystal structure of mcsg target apc22750 from bacillus cereus
PDB Compounds: (A:) hypothetical protein APC22750

SCOPe Domain Sequences for d1vr4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vr4a1 d.230.5.1 (A:1-103) Hypothetical protein BC1012 {Bacillus cereus [TaxId: 1396]}
mivtttsgiqgkeiieyidivngeaimganivrdlfasvrdvvggragsyesklkeardi
amdemkelakqkganaivgvdvdyevvrdgmlmvavsgtavri

SCOPe Domain Coordinates for d1vr4a1:

Click to download the PDB-style file with coordinates for d1vr4a1.
(The format of our PDB-style files is described here.)

Timeline for d1vr4a1: